PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC033675.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GATA
Protein Properties Length: 336aa    MW: 37197.4 Da    PI: 8.5658
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC033675.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.49.9e-19245278134
          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                   C +C +tkTp+WR+gp g+ktLCnaCG++yr+ +
  EcC033675.40 245 CMHCEVTKTPQWREGPMGPKTLCNACGVRYRSGR 278
                   99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.899239275IPR000679Zinc finger, GATA-type
SMARTSM004011.1E-16239289IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.94E-15242302No hitNo description
Gene3DG3DSA:3.30.50.102.2E-14243276IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.02E-14244291No hitNo description
PROSITE patternPS003440245270IPR000679Zinc finger, GATA-type
PfamPF003201.4E-16245278IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006813Biological Processpotassium ion transport
GO:0055085Biological Processtransmembrane transport
GO:0016020Cellular Componentmembrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005249Molecular Functionvoltage-gated potassium channel activity
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
KIDFVGSWIF DDNVNGSSDE FFDNVLKQID FPLEDVESNI LSDDWDASFQ LLELPSSDVL  60
EGFPSSYCGK KCEDISAPDR SLSRAAEIDI SMAFVAFKNS YGEEHNEDKA KVKASPSYTE  120
TNSNRSICHH QTSNDKDSSL ENSSSGSIEN SLLFCSKSLI PVKRSRSKRL RPQTPKTRFN  180
FPFASSASSA SGIYHPLAAS RSSSEGRHTK KSSGKRKGKE KNLHLLSGAE EMNSASQNPS  240
ATRKCMHCEV TKTPQWREGP MGPKTLCNAC GVRYRSGRLF PEYRPAASPS FISSLHSNSH  300
RKVIEMRKNG NHESGFASMN NLRHPQVRMS DGGVPV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1163168RSRSKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010031983.10.0PREDICTED: GATA transcription factor 10-like isoform X1
RefseqXP_010031984.10.0PREDICTED: GATA transcription factor 10-like isoform X2
TrEMBLA0A059AC230.0A0A059AC23_EUCGR; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-50GATA transcription factor 11